PDB entry 1kjk

View 1kjk on RCSB PDB site
Description: Solution structure of the lambda integrase amino-terminal domain
Class: Viral protein
Keywords: DNA recombination, integrase, three-stranded beta-sheet, DNA-binding domain, Viral protein
Deposited on 2001-12-04, released 2002-03-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Enterobacteria phage lambda [TaxId:10710]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kjka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kjkA (A:)
    mgrrrsherrdlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsghk
    hkpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kjkA (A:)
    dlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsgh