PDB entry 1kjg
View 1kjg on RCSB PDB site
Description: substrate shape determines specificity of recognition recognition for hiv-1 protease: analysis of crystal structures of six substrate complexes
Class: hydrolase
Keywords: reverse transcriptase, RNAse h, substrate recognition, hydrolase
Deposited on
2001-12-04, released
2002-03-06
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.46
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (24)
Domains in SCOPe 2.04: d1kjga_ - Chain 'B':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (24)
Domains in SCOPe 2.04: d1kjgb_ - Chain 'P':
Compound: gag polyprotein
Database cross-references and differences (RAF-indexed):
- Heterogens: ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1kjgA (A:)
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1kjgB (B:)
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'P':
No sequence available.