PDB entry 1kjg

View 1kjg on RCSB PDB site
Description: substrate shape determines specificity of recognition recognition for hiv-1 protease: analysis of crystal structures of six substrate complexes
Class: hydrolase
Keywords: reverse transcriptase, RNAse h, substrate recognition, hydrolase
Deposited on 2001-12-04, released 2002-03-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (24)
    Domains in SCOPe 2.01: d1kjga_
  • Chain 'B':
    Compound: Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (24)
    Domains in SCOPe 2.01: d1kjgb_
  • Chain 'P':
    Compound: gag polyprotein
    Database cross-references and differences (RAF-indexed):
    • GB AAK53788 (Start-9)
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kjgA (A:)
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kjgB (B:)
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

  • Chain 'P':
    No sequence available.