PDB entry 1kjf

View 1kjf on RCSB PDB site
Description: substrate shape determines specificity of recognition recognition for hiv-1 protease: analysis of crystal structures of six substrate complexes
Class: hydrolase
Keywords: p1-p6, SUBSTRATE RECOGNITION
Deposited on 2001-12-04, released 2002-03-06
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus 1
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
    • engineered (24)
  Domains in SCOP 1.75: d1kjfa_
• Chain 'B':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus 1
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
    • engineered (24)
  Domains in SCOP 1.75: d1kjfb_
• Chain 'P':
  Compound: gag polyprotein
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20875 (0-9)
• Heterogens: ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kjfA (A:)
  pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kjfB (B:)
  pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'P':
  No sequence available.