PDB entry 1kj9

View 1kj9 on RCSB PDB site
Description: Crystal structure of purt-encoded glycinamide ribonucleotide transformylase complexed with Mg-ATP
Class: transferase
Keywords: ATP-grasp, purine biosynthesis, nucleotide, TRANSFERASE
Deposited on 2001-12-04, released 2002-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylglycinamide formyltransferase 2
    Species: Escherichia coli [TaxId:562]
    Gene: PURT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kj9a1, d1kj9a2, d1kj9a3
  • Chain 'B':
    Compound: phosphoribosylglycinamide formyltransferase 2
    Species: Escherichia coli [TaxId:562]
    Gene: PURT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kj9b1, d1kj9b2, d1kj9b3
  • Heterogens: MG, NA, CL, ATP, MPO, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kj9A (A:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsp
    laleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefa
    lhvraflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgs
    rrlgvalataesvvdaierakhaagqvkvqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kj9A (A:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsplaler
    aqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefalhvra
    flglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgv
    alataesvvdaierakhaagqvkvqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kj9B (B:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsp
    laleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefa
    lhvraflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgs
    rrlgvalataesvvdaierakhaagqvkvqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kj9B (B:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqgggrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsplale
    raqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefalhvr
    aflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlg
    valataesvvdaierakhaagqvkvqg