PDB entry 1kj8

View 1kj8 on RCSB PDB site
Description: Crystal Structure of PurT-Encoded Glycinamide Ribonucleotide Transformylase in Complex with Mg-ATP and GAR
Class: transferase
Keywords: ATP-grasp, purine biosynthesis, nucleotide, TRANSFERASE
Deposited on 2001-12-04, released 2002-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylglycinamide formyltransferase 2
    Species: Escherichia coli [TaxId:562]
    Gene: PURT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kj8a1, d1kj8a2, d1kj8a3
  • Chain 'B':
    Compound: phosphoribosylglycinamide formyltransferase 2
    Species: Escherichia coli [TaxId:562]
    Gene: PURT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kj8b1, d1kj8b2, d1kj8b3
  • Heterogens: MG, NA, CL, ATP, GAR, MPO, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kj8A (A:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsp
    laleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefa
    lhvraflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgs
    rrlgvalataesvvdaierakhaagqvkvqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kj8A (A:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsplaler
    aqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefalhvra
    flglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgv
    alataesvvdaierakhaagqvkvqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kj8B (B:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsp
    laleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefa
    lhvraflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgs
    rrlgvalataesvvdaierakhaagqvkvqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kj8B (B:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qgrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsplaleraq
    eiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefalhvrafl
    glpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgval
    ataesvvdaierakhaagqvkvqg