PDB entry 1kj8

View 1kj8 on RCSB PDB site
Description: crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar
Deposited on 2001-12-04, released 2002-06-28
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-28, with a file datestamp of 2002-06-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.182
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kj8A (A:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsp
    laleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefa
    lhvraflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgs
    rrlgvalataesvvdaierakhaagqvkvqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kj8A (A:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsplaler
    aqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefalhvra
    flglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgv
    alataesvvdaierakhaagqvkvqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kj8B (B:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsp
    laleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefa
    lhvraflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgs
    rrlgvalataesvvdaierakhaagqvkvqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kj8B (B:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qgrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsplaleraq
    eiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefalhvrafl
    glpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgval
    ataesvvdaierakhaagqvkvqg