PDB entry 1kj7

View 1kj7 on RCSB PDB site
Description: substrate shape determines specificity of recognition recognition for hiv-1 protease: analysis of crystal structures of six substrate complexes
Deposited on 2001-12-04, released 2002-03-06
The last revision prior to the SCOP 1.63 freeze date was dated 2002-03-06, with a file datestamp of 2002-03-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1kj7a_
  • Chain 'B':
    Domains in SCOP 1.63: d1kj7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kj7A (A:)
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kj7B (B:)
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf