PDB entry 1kj3

View 1kj3 on RCSB PDB site
Description: Mhc Class I H-2Kb molecule complexed with pKB1 peptide
Class: immune system
Keywords: MHC class I, h-2kb, pmhc complex, allogeneic, immune system
Deposited on 2001-12-04, released 2002-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.211
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: h-2kb MHC class I molecule alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01901 (0-278)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1kj3h1, d1kj3h2, d1kj3h3
  • Chain 'I':
    Compound: h-2kb MHC class I molecule alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kj3i1, d1kj3i2
  • Chain 'L':
    Compound: beta-2 microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kj3l_
  • Chain 'M':
    Compound: beta-2 microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kj3m_
  • Chain 'P':
    Compound: naturally processed octapeptide pkb1
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: naturally processed octapeptide pkb1
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj3H (H:)
    mgphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpey
    weretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyayd
    gcdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatl
    lrtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdg
    tfqkwasvvvplgkeqyytchvyhqglpepltlrweppp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1kj3I (I:)
    mgphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpey
    weretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyayd
    gcdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatl
    lrtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdg
    tfqkwasvvvplgkeqyytchvyhqglpepltlrweppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kj3I (I:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrweppp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj3L (L:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj3M (M:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.