PDB entry 1kj2

View 1kj2 on RCSB PDB site
Description: Murine Alloreactive ScFv TCR-Peptide-MHC Class I Molecule Complex
Deposited on 2001-12-04, released 2002-03-27
The last revision prior to the SCOP 1.71 freeze date was dated 2002-03-27, with a file datestamp of 2002-03-27.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.22
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj2A (A:)
    qqvrqspqsltvwegetailncsyedstfnyfpwyqqfpgegpallisirsvsdkkedgr
    ftiffnkrekklslhitdsqpgdsatyfcaaryqggralifgtgttvsvsp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj2B (B:)
    vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
    lpgadylatrvtdtelrlqvanmsqgrtlyctcsaapdwgasaetlyfgsgtrltvl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj2D (D:)
    qqvrqspqsltvwegetailncsyedstfnyfpwyqqfpgegpallisirsvsdkkedgr
    ftiffnkrekklslhitdsqpgdsatyfcaaryqggralifgtgttvsvsp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj2E (E:)
    vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
    lpgadylatrvtdtelrlqvanmsqgrtlyctcsaapdwgasaetlyfgsgtrltvl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1kj2H (H:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrwepp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kj2H (H:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrwep
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj2I (I:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrwepp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj2L (L:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj2M (M:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm