PDB entry 1kix

View 1kix on RCSB PDB site
Description: Dimeric Structure of the O. nova Telomere End Binding Protein Alpha Subunit with Bound ssDNA
Class: DNA binding protein/DNA
Keywords: TELOMERE BINDING PROTEIN, DNA-PROTEIN INTERACTIONS, SINGLE STRANDED DNA, ssDNA, DNA BINDING PROTEIN/DNA COMPLEX
Deposited on 2001-12-03, released 2002-02-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.208
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Telomere-binding protein alpha subunit
    Species: Sterkiella nova [TaxId:200597]
    Gene: MAC-56A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1kixa1, d1kixa2, d1kixa3
  • Chain 'D':
    Compound: 5'-d(*t*tp*tp*tp*gp*gp*gp*g)-3'
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kixA (A:)
    mstaakqnrstsrvskkktaapkegaakksdkghkyeyvelakasltsaqpqhfyavvid
    atfpyktnqeryicslkivdptlylkqqkgagdasdyatlvlyakrfedlpiihragdii
    rvhratlrlyngqrqfnanvfyssswalfstdkrsvtqeinnqdavsdttpfsfsskhat
    iekneisilqnlrkwanqyfssysvissdmytalnkaqaqkgdfdvvakilqvheldeyt
    nelklkdasgqvfytlslklkfphvrtgevvrirsatydetstqkkvlilshysniitfi
    qssklakelrakiqddhsvevaslkknvslnavvltevdkkhaalpstslqdlfhhadsd
    kelqaqdtfrtqfyvtkiepsdvkewvkgydrktkkssslkgasgkgdnifqvqflvkda
    stqlnnntyrvllytqdglganffnvkadnlhknadarkkledsaelltkfnsyvdavve
    rrngfylikdtkliy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kixA (A:)
    yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdas
    dyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrs
    vtqeinnqdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytalnkaqa
    qkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrirsatyd
    etstqkkvlilshysniitfiqssklakelrakiqddhsslnavvltevdkkhaalpsts
    lqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvkgydrktkkssslkgasgkgdn
    ifqvqflvkdastqlnnntyrvllytqdglganffnvkadnlhknadarkkledsaellt
    kfnsyvdavverrngfylikdtkliy
    

  • Chain 'D':
    No sequence available.