PDB entry 1kiv

View 1kiv on RCSB PDB site
Description: recombinant kringle IV-10/m66 variant of human apolipoprotein(a)
Class: kringle
Keywords: kringle, lysine binding site, apolipoprotein(a)
Deposited on 1998-08-26, released 1999-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.178
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apolipoprotein a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kiva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kivA (A:)
    cyhgngqsyrgtfsttvtgrtcqswssmtphrhqrtpenypndgltmnycrnpdadtgpw
    cftmdpsirweycnltrc