PDB entry 1kiu

View 1kiu on RCSB PDB site
Description: FimH adhesin Q133N mutant-FimC chaperone complex with methyl-alpha-D-mannose
Class: chaperone/cell adhesion
Keywords: adhesin-chaperone complex, mannose-bound, CHAPERONE/CELL ADHESION COMPLEX
Deposited on 2001-12-03, released 2002-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.236
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Gene: fimC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31697 (0-204)
      • conflict (17)
    Domains in SCOPe 2.07: d1kiua1, d1kiua2
  • Chain 'B':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08191 (0-278)
      • engineered (132)
    Domains in SCOPe 2.07: d1kiub1, d1kiub2
  • Chain 'C':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Gene: fimC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31697 (0-204)
      • conflict (17)
    Domains in SCOPe 2.07: d1kiuc1, d1kiuc2
  • Chain 'D':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08191 (0-278)
      • engineered (132)
    Domains in SCOPe 2.07: d1kiud1, d1kiud2
  • Chain 'E':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Gene: fimC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31697 (0-204)
      • conflict (17)
    Domains in SCOPe 2.07: d1kiue1, d1kiue2
  • Chain 'F':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08191 (0-278)
      • engineered (132)
    Domains in SCOPe 2.07: d1kiuf1, d1kiuf2
  • Chain 'G':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Gene: fimC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31697 (0-204)
      • conflict (17)
    Domains in SCOPe 2.07: d1kiug1, d1kiug2
  • Chain 'H':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08191 (0-278)
      • engineered (132)
    Domains in SCOPe 2.07: d1kiuh1, d1kiuh2
  • Chain 'I':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Gene: fimC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31697 (0-204)
      • conflict (17)
    Domains in SCOPe 2.07: d1kiui1, d1kiui2
  • Chain 'J':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08191 (0-278)
      • engineered (132)
    Domains in SCOPe 2.07: d1kiuj1, d1kiuj2
  • Chain 'K':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Gene: fimC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31697 (0-204)
      • conflict (17)
    Domains in SCOPe 2.07: d1kiuk1, d1kiuk2
  • Chain 'L':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08191 (0-278)
      • engineered (132)
    Domains in SCOPe 2.07: d1kiul1, d1kiul2
  • Chain 'M':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Gene: fimC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31697 (0-204)
      • conflict (17)
    Domains in SCOPe 2.07: d1kium1, d1kium2
  • Chain 'N':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08191 (0-278)
      • engineered (132)
    Domains in SCOPe 2.07: d1kiun1, d1kiun2
  • Chain 'O':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Gene: fimC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31697 (0-204)
      • conflict (17)
    Domains in SCOPe 2.07: d1kiuo1, d1kiuo2
  • Chain 'P':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08191 (0-278)
      • engineered (132)
    Domains in SCOPe 2.07: d1kiup1, d1kiup2
  • Heterogens: MMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kiuA (A:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kiuB (B:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrntnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kiuC (C:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kiuD (D:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrntnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kiuE (E:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kiuF (F:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrntnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kiuG (G:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kiuH (H:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrntnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kiuI (I:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kiuJ (J:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrntnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kiuK (K:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kiuL (L:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrntnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kiuM (M:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kiuN (N:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrntnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kiuO (O:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kiuP (P:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrntnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq