PDB entry 1kit

View 1kit on RCSB PDB site
Description: vibrio cholerae neuraminidase
Deposited on 1996-06-21, released 1997-06-05
The last revision prior to the SCOP 1.59 freeze date was dated 1997-06-05, with a file datestamp of 1997-06-10.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.17
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kit_ (-)
    alfdynatgdtefdspakqgwmqdntnngsgvltnadgmpawlvqgiggraqwtyslstn
    qhaqassfgwrmttemkvlsggmitnyyangtqrvlpiisldssgnlvvefegqtgrtvl
    atgtaateyhkfelvflpgsnpsasfyfdgklirdniqptaskqnmivwgngssntdgva
    ayrdikfeiqgdvifrgpdripsivassvtpgvvtafaekrvgggdpgalsntndiitrt
    srdggitwdtelnlteqinvsdefdfsdprpiydpssntvlvsyarwptdaaqngdrikp
    wmpngifysvydvasgnwqapidvtdqvkersfqiagwggselyrrntslnsqqdwqsna
    kirivdgaanqiqvadgsrkyvvtlsidesgglvanlngvsapiilqsehakvhsfhdye
    lqysalnhtttlfvdgqqittwagevsqenniqfgnadaqidgrlhvqkivltqqghnlv
    efdafylaqqtpevekdleklgwtkiktgntmslygnasvnpgpghgitltrqqnisgsq
    ngrliypaivldrfflnvmsiysddggsnwqtgstlpipfrwksssiletlepseadmve
    lqngdllltarldfnqivngvnysprqqflskdggitwslleannanvfsnistgtvdas
    itrfeqsdgshfllftnpqgnpagtngrqnlglwfsfdegvtwkgpiqlvngasaysdiy
    qldsenaivivetdnsnmrilrmpitllkqkltlsqn