PDB entry 1kit

View 1kit on RCSB PDB site
Description: vibrio cholerae neuraminidase
Class: hydrolase
Keywords: hydrolase, glycosidase, signal, repeat, calcium
Deposited on 1996-06-21, released 1997-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.17
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase
    Species: Vibrio cholerae [TaxId:666]
    Gene: NANH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kita1, d1kita2, d1kita3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kitA (A:)
    alfdynatgdtefdspakqgwmqdntnngsgvltnadgmpawlvqgiggraqwtyslstn
    qhaqassfgwrmttemkvlsggmitnyyangtqrvlpiisldssgnlvvefegqtgrtvl
    atgtaateyhkfelvflpgsnpsasfyfdgklirdniqptaskqnmivwgngssntdgva
    ayrdikfeiqgdvifrgpdripsivassvtpgvvtafaekrvgggdpgalsntndiitrt
    srdggitwdtelnlteqinvsdefdfsdprpiydpssntvlvsyarwptdaaqngdrikp
    wmpngifysvydvasgnwqapidvtdqvkersfqiagwggselyrrntslnsqqdwqsna
    kirivdgaanqiqvadgsrkyvvtlsidesgglvanlngvsapiilqsehakvhsfhdye
    lqysalnhtttlfvdgqqittwagevsqenniqfgnadaqidgrlhvqkivltqqghnlv
    efdafylaqqtpevekdleklgwtkiktgntmslygnasvnpgpghgitltrqqnisgsq
    ngrliypaivldrfflnvmsiysddggsnwqtgstlpipfrwksssiletlepseadmve
    lqngdllltarldfnqivngvnysprqqflskdggitwslleannanvfsnistgtvdas
    itrfeqsdgshfllftnpqgnpagtngrqnlglwfsfdegvtwkgpiqlvngasaysdiy
    qldsenaivivetdnsnmrilrmpitllkqkltlsqn