PDB entry 1kik

View 1kik on RCSB PDB site
Description: sh3 domain of lymphocyte specific kinase (lck)
Deposited on 2001-12-03, released 2001-12-12
The last revision prior to the SCOP 1.67 freeze date was dated 2001-12-12, with a file datestamp of 2001-12-12.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1kika_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kikA (A:)
    nlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvakan