PDB entry 1kig

View 1kig on RCSB PDB site
Description: bovine factor xa
Class: complex (protease/inhibitor)
Keywords: glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor)
Deposited on 1997-04-24, released 1998-10-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-12.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.187
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: factor xa
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1kigh_
  • Chain 'I':
    Compound: anticoagulant peptide
    Species: Ornithodoros moubata [TaxId:6938]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1kigi_
  • Chain 'L':
    Compound: factor xa
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1kigl_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kigH (H:)
    ivggrdcaegecpwqallvneenegfcggtilnefyvltaahclhqakrftvrvgdrnte
    qeegnemahevemtvkhsrfvketydfdiavlrlktpirfrrnvapaclpekdwaeatlm
    tqktgivsgfgrthekgrlsstlkmlevpyvdrstcklsssftitpnmfcagydtqpeda
    cqgdsggphvtrfkdtyfvtgivswgegcarkgkfgvytkvsnflkwidkimkaragaag
    s
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kigI (I:)
    ynrlcikprdwidecdsneggerayfrngkggcdsfwicpedhtgadyyssyrdcfnaci
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kigL (L:)
    csldnggcdqfcreersevrcscahgyvlgddskscvsterfpcgkftqgr