PDB entry 1kif

View 1kif on RCSB PDB site
Description: d-amino acid oxidase from pig kidney
Class: flavoprotein
Keywords: fad cofactor, oxidase, flavoenzyme, flavoprotein
Deposited on 1996-01-19, released 1996-07-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.228
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-amino acid oxidase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kifa1, d1kifa2
  • Chain 'B':
    Compound: d-amino acid oxidase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kifb1, d1kifb2
  • Chain 'C':
    Compound: d-amino acid oxidase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kifc1, d1kifc2
  • Chain 'D':
    Compound: d-amino acid oxidase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kifd1, d1kifd2
  • Chain 'E':
    Compound: d-amino acid oxidase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kife1, d1kife2
  • Chain 'F':
    Compound: d-amino acid oxidase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kiff1, d1kiff2
  • Chain 'G':
    Compound: d-amino acid oxidase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kifg1, d1kifg2
  • Chain 'H':
    Compound: d-amino acid oxidase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kifh1, d1kifh2
  • Heterogens: FAD, BEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kifA (A:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernlltmppshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kifA (A:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kifB (B:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernlltmppshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kifB (B:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kifC (C:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernlltmppshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kifC (C:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kifD (D:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernlltmppshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kifD (D:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1kifE (E:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernlltmppshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kifE (E:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1kifF (F:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernlltmppshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kifF (F:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1kifG (G:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernlltmppshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kifG (G:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1kifH (H:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernlltmppshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kifH (H:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl