PDB entry 1kid

View 1kid on RCSB PDB site
Description: groel (hsp60 class) fragment (apical domain) comprising residues 191-376, mutant with ala 262 replaced with leu and ile 267 replaced with met
Deposited on 1996-12-13, released 1997-09-17
The last revision prior to the SCOP 1.55 freeze date was dated 1997-09-17, with a file datestamp of 1997-09-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.18
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1kid__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kid_ (-)
  glvprgsegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavaka
  gkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvise
  eigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydre
  klqervaklaggv