PDB entry 1kic

View 1kic on RCSB PDB site
Description: Inosine-adenosine-guanosine preferring nucleoside hydrolase from Trypanosoma vivax: Asp10Ala mutant in complex with inosine
Class: hydrolase
Keywords: Rossmann-fold-like motif, HYDROLASE
Deposited on 2001-12-03, released 2002-05-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.176
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inosine-adenosine-guanosine preferring nucleoside hydrolase
    Species: Trypanosoma vivax [TaxId:5699]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GPQ4 (13-338)
      • expression tag (12)
      • engineered (21)
      • see remark 999 (312)
    Domains in SCOPe 2.06: d1kica1, d1kica2
  • Chain 'B':
    Compound: inosine-adenosine-guanosine preferring nucleoside hydrolase
    Species: Trypanosoma vivax [TaxId:5699]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GPQ4 (13-338)
      • engineered (21)
      • see remark 999 (312)
    Domains in SCOPe 2.06: d1kicb_
  • Heterogens: CA, NI, NOS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kicA (A:)
    mrgsphhhhhhgsaknvvldhagnlddfvamvllasntekvrligalctdadcfvengfn
    vtgkimclmhnnmnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdki
    kaenekyegqqlladlvmnseekvticvtgplsnvawcidkygekftskveecvimggav
    dvrgnvflpstdgtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfge
    qtnfllsilvgtmwamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkq
    pnegatvrtdaenypltfvarnpeaeffldmllrsarac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kicA (A:)
    saknvvldhagnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnn
    mnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqql
    ladlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstd
    gtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgt
    mwamctyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaenypltfvarn
    peaeffldmllrsarac
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kicB (B:)
    mrgsphhhhhhgsaknvvldhagnlddfvamvllasntekvrligalctdadcfvengfn
    vtgkimclmhnnmnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdki
    kaenekyegqqlladlvmnseekvticvtgplsnvawcidkygekftskveecvimggav
    dvrgnvflpstdgtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfge
    qtnfllsilvgtmwamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkq
    pnegatvrtdaenypltfvarnpeaeffldmllrsarac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kicB (B:)
    aknvvldhagnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnnm
    nlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqqll
    adlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstdg
    taewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgtm
    wamyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaenypltfvarnpea
    effldmllrsarac