PDB entry 1ki9

View 1ki9 on RCSB PDB site
Description: Adenylate kinase from Methanococcus thermolithotrophicus
Class: signaling protein, transferase
Keywords: kinase, phosphotransferase, SIGNALING PROTEIN, TRANSFERASE
Deposited on 2001-12-02, released 2003-06-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: 0.204
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase
    Species: Methanothermococcus thermolithotrophicus [TaxId:2186]
    Gene: adk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1ki9a_
  • Chain 'B':
    Compound: adenylate kinase
    Species: Methanothermococcus thermolithotrophicus [TaxId:2186]
    Gene: adk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1ki9b_
  • Chain 'C':
    Compound: adenylate kinase
    Species: Methanothermococcus thermolithotrophicus [TaxId:2186]
    Gene: adk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1ki9c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ki9A (A:)
    mknklvvvtgvpgvggttitqkameklseeginykmvnfgtvmfevaqeenlvedrdqmr
    kldpdtqkriqklagrkiaemvkespvvvdthstiktpkgylpglpvwvlnelnpdiiiv
    vetsgdeilirrlndetrnrdlettagieehqimnraaamtygvltgatvkiiqnknnll
    dyaveelisvlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ki9A (A:)
    knklvvvtgvpgvggttitqkameklseeginykmvnfgtvmfevaqeenlvedrdqmrk
    ldpdtqkriqklagrkiaemvkespvvvdthstiktpkgylpglpvwvlnelnpdiiivv
    etsgdeilirrlndetrnrdlettagieehqimnraaamtygvltgatvkiiqnknnlld
    yaveelisvlr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ki9B (B:)
    mknklvvvtgvpgvggttitqkameklseeginykmvnfgtvmfevaqeenlvedrdqmr
    kldpdtqkriqklagrkiaemvkespvvvdthstiktpkgylpglpvwvlnelnpdiiiv
    vetsgdeilirrlndetrnrdlettagieehqimnraaamtygvltgatvkiiqnknnll
    dyaveelisvlr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ki9C (C:)
    mknklvvvtgvpgvggttitqkameklseeginykmvnfgtvmfevaqeenlvedrdqmr
    kldpdtqkriqklagrkiaemvkespvvvdthstiktpkgylpglpvwvlnelnpdiiiv
    vetsgdeilirrlndetrnrdlettagieehqimnraaamtygvltgatvkiiqnknnll
    dyaveelisvlr