PDB entry 1ki1

View 1ki1 on RCSB PDB site
Description: Guanine Nucleotide Exchange Region of Intersectin in Complex with Cdc42
Class: signaling protein
Keywords: Protein-Protein complex, DH domain, PH domain, Rho GTPase, SIGNALING PROTEIN
Deposited on 2001-12-02, released 2002-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.231
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G25K GTP-binding protein, placental isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ki1a_
  • Chain 'B':
    Compound: intersectin long form
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ki1b1, d1ki1b2
  • Chain 'C':
    Compound: G25K GTP-binding protein, placental isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ki1c_
  • Chain 'D':
    Compound: intersectin long form
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ki1d1, d1ki1d2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ki1A (A:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkksrrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ki1A (A:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ki1B (B:)
    dmltpterkrqgyihelivteenyvndlqlvteifqkplmeselltekevamifvnwkel
    imcnikllkalrvrkkmsgekmpvkmigdilsaqlphmqpyirfcsrqlngaaliqqktd
    eapdfkefvkrlemdprckgmplssfilkpmqrvtrypliiknilentpenhpdhshlkh
    alekaeelcsqvnegvrekensdrlewiqahvqceglseqlvfnsvtnclgprkflhsgk
    lykaknnkelygflfndfllltqitkplgssgtdkvfspksnlqymyktpiflnevlvkl
    ptdpsgdepifhishidrvytlraesinertawvqkikaaselyietekkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ki1B (B:)
    dmltpterkrqgyihelivteenyvndlqlvteifqkplmeselltekevamifvnwkel
    imcnikllkalrvrkkmsgekmpvkmigdilsaqlphmqpyirfcsrqlngaaliqqktd
    eapdfkefvkrlemdprckgmplssfilkpmqrvtrypliiknilentpenhpdhshlkh
    alekaeelcsqvnegvrekensdrlewiqahvqceglseqlvfnsvtnclgprkflhsgk
    lykaknnkelygflfndfllltqitkpkvfspksnlqymyktpiflnevlvklptdpsgd
    fhishidrvytlraesinertawvqkikaaselyietekkkr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ki1C (C:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkksrrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ki1C (C:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ki1D (D:)
    dmltpterkrqgyihelivteenyvndlqlvteifqkplmeselltekevamifvnwkel
    imcnikllkalrvrkkmsgekmpvkmigdilsaqlphmqpyirfcsrqlngaaliqqktd
    eapdfkefvkrlemdprckgmplssfilkpmqrvtrypliiknilentpenhpdhshlkh
    alekaeelcsqvnegvrekensdrlewiqahvqceglseqlvfnsvtnclgprkflhsgk
    lykaknnkelygflfndfllltqitkplgssgtdkvfspksnlqymyktpiflnevlvkl
    ptdpsgdepifhishidrvytlraesinertawvqkikaaselyietekkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ki1D (D:)
    dmltpterkrqgyihelivteenyvndlqlvteifqkplmeselltekevamifvnwkel
    imcnikllkalrvrkkmsgekmpvkmigdilsaqlphmqpyirfcsrqlngaaliqqktd
    eapdfkefvkrlemdprckgmplssfilkpmqrvtrypliiknilentpenhpdhshlkh
    alekaeelcsqvnegvrekensdrlewiqahvqceglseqlvfnsvtnclgprkflhsgk
    lykaknnkelygflfndfllltqitkpkvfspksnlqymyktpiflnevlvklptdpsgd
    fhishidrvytlraesinertawvqkikaaselyietekkkr