PDB entry 1khy

View 1khy on RCSB PDB site
Description: The Crystal Structure of ClpB N Terminal Domain, Implication to the Peptide Binding Function of ClpB
Class: chaperone
Keywords: alpha helix, CHAPERONE
Deposited on 2001-12-01, released 2002-12-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.222
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: clpb protein
    Species: Escherichia coli [TaxId:562]
    Gene: clpb
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63284
      • modified residue (34)
    Domains in SCOPe 2.06: d1khya_
  • Chain 'B':
    Compound: clpb protein
    Species: Escherichia coli [TaxId:562]
    Gene: clpb
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63284
      • modified residue (34)
    Domains in SCOPe 2.06: d1khyb_
  • Chain 'C':
    Compound: clpb protein
    Species: Escherichia coli [TaxId:562]
    Gene: clpb
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63284
      • modified residue (34)
      • modified residue (142)
    Domains in SCOPe 2.06: d1khyc_
  • Chain 'D':
    Compound: clpb protein
    Species: Escherichia coli [TaxId:562]
    Gene: clpb
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63284
      • modified residue (34)
      • modified residue (142)
    Domains in SCOPe 2.06: d1khyd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1khyA (A:)
    mrldrltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagql
    rtdinqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrg
    tladilkaagattanitqaieqmrgges
    

    Sequence, based on observed residues (ATOM records): (download)
    >1khyA (A:)
    drltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrtd
    inqalnrlpqvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtladilkaag
    attanitqaieq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1khyB (B:)
    mrldrltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagql
    rtdinqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrg
    tladilkaagattanitqaieqmrgges
    

    Sequence, based on observed residues (ATOM records): (download)
    >1khyB (B:)
    ldrltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrt
    dinqalnrlpqvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtladilkaa
    gattanitqaieq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1khyC (C:)
    mrldrltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagql
    rtdinqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrg
    tladilkaagattanitqaieqmrgges
    

    Sequence, based on observed residues (ATOM records): (download)
    >1khyC (C:)
    drltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrtd
    inqalnrlpqvdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtladilka
    agattanitqaieqm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1khyD (D:)
    mrldrltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagql
    rtdinqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrg
    tladilkaagattanitqaieqmrgges
    

    Sequence, based on observed residues (ATOM records): (download)
    >1khyD (D:)
    drltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrtd
    inqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtla
    dilkaagattanitqaieqm