PDB entry 1khy

View 1khy on RCSB PDB site
Description: the crystal structure of clpb n terminal domain, implication to the peptide binding function of clpb
Deposited on 2001-12-01, released 2002-12-04
The last revision prior to the SCOP 1.65 freeze date was dated 2002-12-04, with a file datestamp of 2002-12-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.222
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1khya_
  • Chain 'B':
    Domains in SCOP 1.65: d1khyb_
  • Chain 'C':
    Domains in SCOP 1.65: d1khyc_
  • Chain 'D':
    Domains in SCOP 1.65: d1khyd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1khyA (A:)
    mrldrltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagql
    rtdinqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrg
    tladilkaagattanitqaieqmrgges
    

    Sequence, based on observed residues (ATOM records): (download)
    >1khyA (A:)
    drltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrtd
    inqalnrlpqvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtladilkaag
    attanitqaieq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1khyB (B:)
    mrldrltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagql
    rtdinqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrg
    tladilkaagattanitqaieqmrgges
    

    Sequence, based on observed residues (ATOM records): (download)
    >1khyB (B:)
    ldrltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrt
    dinqalnrlpqvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtladilkaa
    gattanitqaieq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1khyC (C:)
    mrldrltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagql
    rtdinqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrg
    tladilkaagattanitqaieqmrgges
    

    Sequence, based on observed residues (ATOM records): (download)
    >1khyC (C:)
    drltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrtd
    inqalnrlpqvdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtladilka
    agattanitqaieqm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1khyD (D:)
    mrldrltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagql
    rtdinqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrg
    tladilkaagattanitqaieqmrgges
    

    Sequence, based on observed residues (ATOM records): (download)
    >1khyD (D:)
    drltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrtd
    inqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtla
    dilkaagattanitqaieqm