PDB entry 1khu

View 1khu on RCSB PDB site
Description: Smad1 crystal structure reveals the details of BMP signaling pathway
Deposited on 2001-12-01, released 2001-12-12
The last revision prior to the SCOP 1.61 freeze date was dated 2001-12-12, with a file datestamp of 2001-12-12.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.239
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1khua_
  • Chain 'B':
    Domains in SCOP 1.61: d1khub_
  • Chain 'C':
    Domains in SCOP 1.61: d1khuc_
  • Chain 'D':
    Domains in SCOP 1.61: d1khud_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1khuA (A:)
    pkhwcsivyyelnnrvgeafhasstsvlvdgftdpsnnknrfclgllsnvnrnstientr
    rhigkgvhlyyvggevyaeclsdssifvqsrncnyhhgfhpttvckipsgcslkifnnqe
    faqllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplqwl
    dkvltqmgsphnpissvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1khuB (B:)
    khwcsivyyelnnrvgeafhasstsvlvdgftdpsnnknrfclgllsnvnrnstientrr
    higkgvhlyyvggevyaeclsdssifvqsrncnyhhgfhpttvckipsgcslkifnnqef
    aqllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplqwld
    kvltqmgsphnpissvs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1khuC (C:)
    khwcsivyyelnnrvgeafhasstsvlvdgftdpsnnknrfclgllsnvnrnstientrr
    higkgvhlyyvggevyaeclsdssifvqsrncnyhhgfhpttvckipsgcslkifnnqef
    aqllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplqwld
    kvltqmgsphnpissvs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1khuD (D:)
    hwcsivyyelnnrvgeafhasstsvlvdgftdpsnnknrfclgllsnvnrnstientrrh
    igkgvhlyyvggevyaeclsdssifvqsrncnyhhgfhpttvckipsgcslkifnnqefa
    qllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplqwldk
    vltq