PDB entry 1khu

View 1khu on RCSB PDB site
Description: Smad1 crystal structure reveals the details of BMP signaling pathway
Class: transcription
Keywords: beta-strand sandwich, TRANSCRIPTION
Deposited on 2001-12-01, released 2001-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.239
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: smad1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1khua_
  • Chain 'B':
    Compound: smad1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1khub_
  • Chain 'C':
    Compound: smad1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1khuc_
  • Chain 'D':
    Compound: smad1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1khud_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1khuA (A:)
    applpseinrgdvqavayeepkhwcsivyyelnnrvgeafhasstsvlvdgftdpsnnkn
    rfclgllsnvnrnstientrrhigkgvhlyyvggevyaeclsdssifvqsrncnyhhgfh
    pttvckipsgcslkifnnqefaqllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrq
    dvtstpcwieihlhgplqwldkvltqmgsphnpissvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1khuA (A:)
    pkhwcsivyyelnnrvgeafhasstsvlvdgftdpsnnknrfclgllsnvnrnstientr
    rhigkgvhlyyvggevyaeclsdssifvqsrncnyhhgfhpttvckipsgcslkifnnqe
    faqllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplqwl
    dkvltqmgsphnpissvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1khuB (B:)
    applpseinrgdvqavayeepkhwcsivyyelnnrvgeafhasstsvlvdgftdpsnnkn
    rfclgllsnvnrnstientrrhigkgvhlyyvggevyaeclsdssifvqsrncnyhhgfh
    pttvckipsgcslkifnnqefaqllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrq
    dvtstpcwieihlhgplqwldkvltqmgsphnpissvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1khuB (B:)
    khwcsivyyelnnrvgeafhasstsvlvdgftdpsnnknrfclgllsnvnrnstientrr
    higkgvhlyyvggevyaeclsdssifvqsrncnyhhgfhpttvckipsgcslkifnnqef
    aqllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplqwld
    kvltqmgsphnpissvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1khuC (C:)
    applpseinrgdvqavayeepkhwcsivyyelnnrvgeafhasstsvlvdgftdpsnnkn
    rfclgllsnvnrnstientrrhigkgvhlyyvggevyaeclsdssifvqsrncnyhhgfh
    pttvckipsgcslkifnnqefaqllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrq
    dvtstpcwieihlhgplqwldkvltqmgsphnpissvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1khuC (C:)
    khwcsivyyelnnrvgeafhasstsvlvdgftdpsnnknrfclgllsnvnrnstientrr
    higkgvhlyyvggevyaeclsdssifvqsrncnyhhgfhpttvckipsgcslkifnnqef
    aqllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplqwld
    kvltqmgsphnpissvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1khuD (D:)
    applpseinrgdvqavayeepkhwcsivyyelnnrvgeafhasstsvlvdgftdpsnnkn
    rfclgllsnvnrnstientrrhigkgvhlyyvggevyaeclsdssifvqsrncnyhhgfh
    pttvckipsgcslkifnnqefaqllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrq
    dvtstpcwieihlhgplqwldkvltqmgsphnpissvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1khuD (D:)
    hwcsivyyelnnrvgeafhasstsvlvdgftdpsnnknrfclgllsnvnrnstientrrh
    igkgvhlyyvggevyaeclsdssifvqsrncnyhhgfhpttvckipsgcslkifnnqefa
    qllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplqwldk
    vltq