PDB entry 1khq

View 1khq on RCSB PDB site
Description: orthorhombic form of papain/zlfg-dam covalent complex
Class: hydrolase
Keywords: protease inhibitor, diazomethylketone inhibitor, irreversible inhibitor
Deposited on 2001-11-30, released 2003-09-09
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.149
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: papain
    Species: Carica papaya
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1khqa_
  • Chain 'I':
    Compound: peptidic inhibitor
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1khqA (A:)
ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlneyseqelldcdrrs
ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynega
llysianqpvsvvleaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
wgengyirikrgtgnsygvcglytssfypvkn

  • Chain 'I':
    No sequence available.