PDB entry 1khp

View 1khp on RCSB PDB site
Description: Monoclinic form of papain/ZLFG-DAM covalent complex
Class: hydrolase/hydrolase inhibitor
Keywords: protease inhibitor, diazomethylketone inhibitor, irreversible inhibitor, hydrolase-hydrolase inhibitor complex
Deposited on 2001-11-30, released 2003-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: papain
    Species: Carica papaya [TaxId:3649]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1khpa_
  • Chain 'I':
    Compound: peptidic inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 1KHP (Start-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1khpA (A:)
    ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlneyseqelldcdrrs
    ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynega
    llysianqpvsvvleaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
    wgengyirikrgtgnsygvcglytssfypvkn
    

  • Chain 'I':
    No sequence available.