PDB entry 1khm

View 1khm on RCSB PDB site
Description: c-terminal kh domain of hnrnp k (kh3)
Class: RNA binding protein
Keywords: hnrnp k, kh domain, three-dimensional structure, nmr, c-myc, dipolar coupling, DNA-binding, RNA-binding, RNA binding protein
Deposited on 1999-01-07, released 2000-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (hnrnp k)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61978 (0-88)
    • conflict (1-3)
    • see remark 999 (25)
  Domains in SCOPe 2.07: d1khma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1khmA (A:)
  gspnsygdlggpiittqvtipkdlarsiigkggqrikqirhesgasikideplegsedri
  ititgtqdqiqnaqyllqnsvkqysgkff