PDB entry 1khm

View 1khm on RCSB PDB site
Description: c-terminal kh domain of hnrnp k (kh3)
Class: RNA binding protein
Keywords: hnrnp k, kh domain, three-dimensional structure, nmr, c-myc, dipolar coupling, DNA-binding, RNA-binding
Deposited on 1999-01-07, released 2000-01-12
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (hnrnp k)
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61978 (0-88)
    • conflict (1-3)
    • see remark 999 (25)
  Domains in SCOP 1.73: d1khma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1khmA (A:)
  gspnsygdlggpiittqvtipkdlarsiigkggqrikqirhesgasikideplegsedri
  ititgtqdqiqnaqyllqnsvkqysgkff