PDB entry 1khm

View 1khm on RCSB PDB site
Description: c-terminal kh domain of hnrnp k (kh3)
Deposited on 1999-01-07, released 2000-01-12
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-12, with a file datestamp of 2000-01-11.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1khma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1khmA (A:)
gspnsygdlggpiittqvtipkdlarsiigkggqrikqirhesgasikideplegsedri
ititgtqdqiqnaqyllqnsvkqysgkff