PDB entry 1khl

View 1khl on RCSB PDB site
Description: e. coli alkaline phosphatase mutant (d153hd330n) complex with phosphate
Class: hydrolase
Keywords: alkaline phosphatase, hydrolase
Deposited on 2001-11-30, released 2002-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.183
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (Start-448)
      • conflict (14)
      • conflict (34)
      • engineered (152)
      • conflict (175)
      • conflict (227)
      • conflict (229)
      • engineered (329)
    Domains in SCOPe 2.07: d1khla_
  • Chain 'B':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (Start-448)
      • conflict (14)
      • conflict (34)
      • engineered (152)
      • conflict (175)
      • conflict (227)
      • conflict (229)
      • engineered (329)
    Domains in SCOPe 2.07: d1khlb_
  • Heterogens: ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1khlA (A:)
    tpempvlenraaqgnitapggarrltgdqtaalrnslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqhatpaalvahvtsrkcygpsatsqkcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreeaeargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqnhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1khlA (A:)
    vlenraaqgnitapggarrltgdqtaalrnslsdkpakniilligdgmgdseitaarnya
    egaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvdih
    ekdhptilemakaaglatgnvstaelqhatpaalvahvtsrkcygpsatsqkcpgnalek
    ggkgsiteqllnaradvtlgggaktfaetatagewqgktlreeaeargyqlvsdaaslns
    vteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmtdk
    aiellsknekgfflqvegasidkqnhaanpcgqigetvdldeavqralefakkegntlvi
    vtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaaygph
    aanvvgltdqtdlfytmkaalglk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1khlB (B:)
    tpempvlenraaqgnitapggarrltgdqtaalrnslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqhatpaalvahvtsrkcygpsatsqkcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreeaeargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqnhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1khlB (B:)
    vlenraaqgnitapggarrltgdqtaalrnslsdkpakniilligdgmgdseitaarnya
    egaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvdih
    ekdhptilemakaaglatgnvstaelqhatpaalvahvtsrkcygpsatsqkcpgnalek
    ggkgsiteqllnaradvtlgggaktfaetatagewqgktlreeaeargyqlvsdaaslns
    vteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmtdk
    aiellsknekgfflqvegasidkqnhaanpcgqigetvdldeavqralefakkegntlvi
    vtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaaygph
    aanvvgltdqtdlfytmkaalglk