PDB entry 1khi

View 1khi on RCSB PDB site
Description: crystal structure of hex1
Class: structural protein
Keywords: hex1, neurospora crassa, membrane sealing, peroxisomal target, structural protein
Deposited on 2001-11-30, released 2002-11-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.198
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hex1
    Species: Neurospora crassa [TaxId:5141]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1khia1, d1khia2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1khiA (A:)
    mgyydddahghveadaaprattgtgtgsasqtvtipchhirlgdililqgrpcqvirist
    saatgqhrylgvdlftkqlheessfvsnpapsvvvqtmlgpvfkqyrvldmqdgsivamt
    etgdvkqnlpvidqsslwnrlqkafesgrgsvrvlvvsdhgremavdmkvvhgsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1khiA (A:)
    gsasqtvtipchhirlgdililqgrpcqviristsaatgqhrylgvdlftkqlheessfv
    snpapsvvvqtmlgpvfkqyrvldmqdgsivamtetgdvkqnlpvidqsslwnrlqkafe
    sgrgsvrvlvvsdhgremavdmkvvhg