PDB entry 1khc

View 1khc on RCSB PDB site
Description: Crystal Structure of the PWWP Domain of Mammalian DNA Methyltransferase Dnmt3b
Deposited on 2001-11-29, released 2002-02-27
The last revision prior to the SCOP 1.71 freeze date was dated 2002-03-13, with a file datestamp of 2002-03-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1khca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1khcA (A:)
    gdsteyqddkefgigdlvwgkikgfswwpamvvswkatskrqampgmrwvqwfgdgkfse
    isadklvalglfsqhfnlatfnklvsyrkamyhtlekarvragktfssspgesledqlkp
    mlewahggfkptgieglkpnkkqpenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1khcA (A:)
    teyqddkefgigdlvwgkikgfswwpamvvswkatskrqampgmrwvqwfgdgkfseisa
    dklvalglfsqhfnlatfnklvsyrkamyhtlekarvragktfssspgesledqlkpmle
    wahggfkptgieglkpn