PDB entry 1kh8

View 1kh8 on RCSB PDB site
Description: Structure of a cis-proline (P114) to glycine variant of Ribonuclease A
Class: hydrolase
Keywords: RNase A, ribonuclease A, proline, cis, trans, Cesium, HYDROLASE
Deposited on 2001-11-29, released 2003-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pancreatic Ribonuclease A
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (1-124)
    • initiating met (0)
    • engineered (114)
  Domains in SCOPe 2.08: d1kh8a_
• Heterogens: SO4, CS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kh8A (A:)
  mketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcs
  qknvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegngyvpvh
  fdasv