PDB entry 1kh0

View 1kh0 on RCSB PDB site
Description: Accurate Computer Base Design of a New Backbone Conformation in the Second Turn of Protein L
Class: protein binding
Keywords: Protein L B1 domain, computational based protein design, Type 1' beta turn, extensive amino acid mutations., PROTEIN BINDING
Deposited on 2001-11-28, released 2002-01-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51912 (0-64)
      • engineered (24)
      • engineered (28)
      • engineered (31-32)
      • engineered (45)
      • engineered (47)
      • insertion (49-50)
      • engineered (52-57)
    Domains in SCOPe 2.02: d1kh0a_
  • Chain 'B':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51912 (0-64)
      • engineered (24)
      • engineered (28)
      • engineered (31-32)
      • engineered (45)
      • engineered (47)
      • insertion (49-50)
      • engineered (52-57)
    Domains in SCOPe 2.02: d1kh0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kh0A (A:)
    eevtikanlifangstqtaefkgtkekalsevlayadtlkkdngewtidkrvtngviiln
    ikfag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kh0B (B:)
    eevtikanlifangstqtaefkgtkekalsevlayadtlkkdngewtidkrvtngviiln
    ikfag