PDB entry 1kh0

View 1kh0 on RCSB PDB site
Description: accurate computer base design of a new backbone conformation in the second turn of protein l
Deposited on 2001-11-28, released 2002-01-23
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-07, with a file datestamp of 2002-08-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1kh0a_
  • Chain 'B':
    Domains in SCOP 1.61: d1kh0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kh0A (A:)
eevtikanlifangstqtaefkgtkekalsevlayadtlkkdngewtidkrvtngviiln
ikfag

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kh0B (B:)
eevtikanlifangstqtaefkgtkekalsevlayadtlkkdngewtidkrvtngviiln
ikfag