PDB entry 1kgy

View 1kgy on RCSB PDB site
Description: Crystal Structure of the EphB2-ephrinB2 complex
Class: transferase/transferase receptor
Keywords: Developmental protein, TRANSFERASE/TRANSFERASE RECEPTOR COMPLEX
Deposited on 2001-11-28, released 2002-05-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.243
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ephrin type-b receptor 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1kgya_
  • Chain 'B':
    Compound: ephrin type-b receptor 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1kgyb_
  • Chain 'C':
    Compound: ephrin type-b receptor 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1kgyc_
  • Chain 'D':
    Compound: ephrin type-b receptor 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54763 (0-180)
      • conflict (0)
    Domains in SCOPe 2.04: d1kgyd_
  • Chain 'E':
    Compound: ephrin-b2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52800
      • conflict (18)
    Domains in SCOPe 2.04: d1kgye_
  • Chain 'F':
    Compound: ephrin-b2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52800
      • conflict (18)
    Domains in SCOPe 2.04: d1kgyf_
  • Chain 'G':
    Compound: ephrin-b2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52800
      • conflict (18)
    Domains in SCOPe 2.04: d1kgyg_
  • Chain 'H':
    Compound: ephrin-b2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52800 (0-137)
      • conflict (18)
    Domains in SCOPe 2.04: d1kgyh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kgyA (A:)
    aeetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfi
    rrrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkv
    dtiaadesfsqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyrkcp
    r
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kgyB (B:)
    aeetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfi
    rrrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkv
    dtiaadesfsqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyrkcp
    r
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kgyC (C:)
    aeetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfi
    rrrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkv
    dtiaadesfsqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyrkcp
    r
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kgyD (D:)
    aeetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfi
    rrrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkv
    dtiaadesfsqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyrkcp
    r
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kgyE (E:)
    ivlepiywnssnskflpggglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqad
    rctikkentpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegldn
    qeggvcqtramkilmkvg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kgyF (F:)
    ivlepiywnssnskflpggglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqad
    rctikkentpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegldn
    qeggvcqtramkilmkvg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kgyG (G:)
    ivlepiywnssnskflpggglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqad
    rctikkentpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegldn
    qeggvcqtramkilmkvg
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kgyH (H:)
    ivlepiywnssnskflpggglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqad
    rctikkentpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegldn
    qeggvcqtramkilmkvg