PDB entry 1kgs

View 1kgs on RCSB PDB site
Description: Crystal Structure at 1.50 A of an OmpR/PhoB Homolog from Thermotoga maritima
Class: DNA binding protein
Keywords: DNA-binding protein, alph-beta sandwich, winged-helix, helix-turn-helix, response regulator, DNA BINDING PROTEIN
Deposited on 2001-11-28, released 2001-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.181
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA binding response regulator d
    Species: Thermotoga maritima [TaxId:2336]
    Gene: DRRD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYN0 (Start-224)
      • modified residue (25)
      • modified residue (38)
      • modified residue (40)
      • modified residue (54)
      • modified residue (67)
      • modified residue (78)
      • modified residue (94)
      • modified residue (164)
    Domains in SCOPe 2.07: d1kgsa1, d1kgsa2
  • Heterogens: SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kgsA (A:)
    mnvrvlvvederdladlitealkkemftvdvcydgeegmymalnepfdvvildimlpvhd
    gweilksmresgvntpvlmltalsdveyrvkglnmgaddylpkpfdlreliarvralirr
    kseskstklvcgdlildtatkkayrgskeidltkkeyqileylvmnknrvvtkeelqehl
    wsfddevfsdvlrshiknlrkkvdkgfkkkiihtvrgigyvarde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgsA (A:)
    nvrvlvvederdladlitealkkemftvdvcydgeegmymalnepfdvvildimlpvhdg
    weilksmresgvntpvlmltalsdveyrvkglnmgaddylpkpfdlreliarvralirrk
    seskstklvcgdlildtatkkayrgskeidltkkeyqileylvmnknrvvtkeelqehlw
    vfsdvlrshiknlrkkvdkgfkkkiihtvrgigyvarde