PDB entry 1kgl

View 1kgl on RCSB PDB site
Description: Solution structure of cellular retinol binding protein type-I in complex with all-trans-retinol
Class: lipid binding protein
Keywords: beta barrel, retinoid carrier, holo form, nmr spectroscopy, 15n isotope enrichment, lipid binding protein
Deposited on 2001-11-27, released 2002-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellular retinol-binding protein type I
    Species: Rattus norvegicus [TaxId:10116]
    Gene: RBP-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kgla_
  • Heterogens: RTL

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kglA (A:)
mpvdfngywkmlsnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrn
yimdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlem
raegvtckqvfkkvh