PDB entry 1kgj

View 1kgj on RCSB PDB site
Description: Rat transthyretin (also called prealbumin) complex with 3',5'-dibromoflavone (EMD21388)
Class: transport protein
Keywords: prealbumin, transport, dibromoflavone, aurone, thyroid hormone, transport protein
Deposited on 2001-11-27, released 2002-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kgja_
  • Chain 'B':
    Compound: Transthyretin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kgjb_
  • Chain 'C':
    Compound: Transthyretin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kgjc_
  • Chain 'D':
    Compound: Transthyretin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kgjd_
  • Heterogens: FL8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kgjA (A:)
    gpggageskcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhgltt
    dekftegvyrveldtksywkalgispfheyaevvftandsghrhytiaallspysystta
    vvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgjA (A:)
    ageskcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekf
    tegvyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsn
    pqn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kgjB (B:)
    gpggageskcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhgltt
    dekftegvyrveldtksywkalgispfheyaevvftandsghrhytiaallspysystta
    vvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgjB (B:)
    eskcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfte
    gvyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpq
    n
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kgjC (C:)
    gpggageskcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhgltt
    dekftegvyrveldtksywkalgispfheyaevvftandsghrhytiaallspysystta
    vvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgjC (C:)
    eskcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfte
    gvyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpq
    n
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kgjD (D:)
    gpggageskcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhgltt
    dekftegvyrveldtksywkalgispfheyaevvftandsghrhytiaallspysystta
    vvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgjD (D:)
    skcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfteg
    vyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpqn