PDB entry 1kgi

View 1kgi on RCSB PDB site
Description: Rat transthyretin (also called prealbumin) complex with 3,3',5,5'-tetraiodothyroacetic acid (t4ac)
Class: transport protein
Keywords: prealbumin, transport, tetraiodothyroacetic acid, thyroid ho, transport protein
Deposited on 2001-11-27, released 2002-11-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1kgia_
  • Chain 'B':
    Compound: Transthyretin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1kgib_
  • Chain 'C':
    Compound: Transthyretin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1kgic_
  • Chain 'D':
    Compound: Transthyretin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1kgid_
  • Heterogens: T4A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kgiA (A:)
    gpggageskcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhgltt
    dekftegvyrveldtksywkalgispfheyaevvftandsghrhytiaallspysystta
    vvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgiA (A:)
    skcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfteg
    vyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpqn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kgiB (B:)
    gpggageskcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhgltt
    dekftegvyrveldtksywkalgispfheyaevvftandsghrhytiaallspysystta
    vvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgiB (B:)
    skcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfteg
    vyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpqn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kgiC (C:)
    gpggageskcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhgltt
    dekftegvyrveldtksywkalgispfheyaevvftandsghrhytiaallspysystta
    vvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgiC (C:)
    eskcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfte
    gvyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpq
    n
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kgiD (D:)
    gpggageskcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhgltt
    dekftegvyrveldtksywkalgispfheyaevvftandsghrhytiaallspysystta
    vvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgiD (D:)
    skcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfteg
    vyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpqn