PDB entry 1kgf

View 1kgf on RCSB PDB site
Description: structure of beta-lactamase asn 170 gln mutant
Class: hydrolase
Keywords: hydrolase, antibiotic resistance, signal, plasmid, transposable element
Deposited on 1996-10-17, released 1997-03-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.179
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: BLAZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00807 (1-257)
      • engineered (137)
    Domains in SCOPe 2.05: d1kgfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kgfA (A:)
    mkelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynkln
    kkvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrl
    kelgdkvtnpvryeielqyyspkskkdtstpaafgktlnkliangklskenkkflldlml
    nnksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksd
    kpndklisetaksvmkef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgfA (A:)
    kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
    kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
    elgdkvtnpvryeielqyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
    nksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk
    pndklisetaksvmkef