PDB entry 1kge

View 1kge on RCSB PDB site
Description: structure of beta-lactamase asn 170 met mutant
Class: hydrolase
Keywords: hydrolase, antibiotic resistance, signal, plasmid, transposable element, beta-lactamase
Deposited on 1996-10-17, released 1997-04-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.156
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: BLAZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00807 (1-257)
      • engineered (137)
    Domains in SCOPe 2.05: d1kgea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kgeA (A:)
    mkelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynkln
    kkvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrl
    kelgdkvtnpvryeielmyyspkskkdtstpaafgktlnkliangklskenkkflldlml
    nnksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksd
    kpndklisetaksvmkef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgeA (A:)
    kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
    kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
    elgdkvtnpvryeielmyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
    nksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk
    pndklisetaksvmkef