PDB entry 1kgd

View 1kgd on RCSB PDB site
Description: Crystal Structure of the Guanylate Kinase-like Domain of Human CASK
Class: protein binding
Keywords: maguk, cask, guanylate kinase like domain, protein binding
Deposited on 2001-11-26, released 2001-12-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: 0.188
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peripheral plasma membrane cask
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14936 (4-179)
      • see remark 999 (2-3)
    Domains in SCOPe 2.02: d1kgda_
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kgdA (A:)
    gshmrktlvllgahgvgrrhikntlitkhpdrfaypiphttrppkkdeengknyyfvshd
    qmmqdisnneyleygshedamygtkletirkiheqgliaildvepqalkvlrtaefapfv
    vfiaaptitpglnedeslqrlqkesdilqrtyahyfdltiinneidetirhleeavelvc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgdA (A:)
    hmrktlvllgahgvgrrhikntlitkhpdrfaypiphttrppeengknyyfvshdqmmqd
    isnneyleygshedamygtkletirkiheqgliaildvepqalkvlrtaefapfvvfiaa
    ptitpglnedeslqrlqkesdilqrtyahyfdltiinneidetirhleeavelvc