PDB entry 1kg0

View 1kg0 on RCSB PDB site
Description: Structure of the Epstein-Barr Virus gp42 Protein Bound to the MHC class II Receptor HLA-DR1
Class: Viral protein/Immune system
Keywords: virus, c-type lectin domain, membrane fusion, MHC, Viral protein/Immune system COMPLEX
Deposited on 2001-11-25, released 2002-03-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.221
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II Receptor HLA-DR1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kg0a1, d1kg0a2
  • Chain 'B':
    Compound: MHC class II Receptor HLA-DR1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kg0b1, d1kg0b2
  • Chain 'C':
    Compound: gp42 Protein
    Species: Human herpesvirus 4 [TaxId:10376]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03205 (0-135)
      • conflict (49)
    Domains in SCOPe 2.06: d1kg0c_
  • Chain 'D':
    Compound: Hemagglutinin HA Peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1KG0 (0-12)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kg0A (A:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefda
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kg0B (B:)
    trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
    sqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvypsktqplqhhnllvcsvsgf
    ypgsievrwfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsvts
    pltvewra
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kg0C (C:)
    htfqvpqnytkanctycntreytfsykgccfyftkkkhtwngcfqacaekypctyfygpt
    pdilpvvtrnlnaieslwvgvyrvgegnwtsldggtfkvyqifgshctyvskfstvpvsh
    hecsflkpclcvsqrs
    

  • Chain 'D':
    No sequence available.