PDB entry 1kg0

View 1kg0 on RCSB PDB site
Description: structure of the epstein-barr virus gp42 protein bound to the mhc class ii receptor hla-dr1
Deposited on 2001-11-25, released 2002-03-27
The last revision prior to the SCOP 1.63 freeze date was dated 2002-03-27, with a file datestamp of 2002-03-27.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.221
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kg0A (A:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefda
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kg0B (B:)
    trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
    sqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvypsktqplqhhnllvcsvsgf
    ypgsievrwfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsvts
    pltvewra
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kg0C (C:)
    htfqvpqnytkanctycntreytfsykgccfyftkkkhtwngcfqacaekypctyfygpt
    pdilpvvtrnlnaieslwvgvyrvgegnwtsldggtfkvyqifgshctyvskfstvpvsh
    hecsflkpclcvsqrs