PDB entry 1kfw

View 1kfw on RCSB PDB site
Description: Structure of catalytic domain of psychrophilic chitinase B from Arthrobacter TAD20
Class: hydrolase
Keywords: TIM barrel
Deposited on 2001-11-23, released 2002-11-23
The last revision prior to the SCOP 1.73 freeze date was dated 2002-11-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.174
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase b
    Species: Arthrobacter sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kfwa1, d1kfwa2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kfwA (A:)
    pltstvngyrnvgyfaqwgvygrafqakqldvsgtaknlthinysfgninnqtltcfman
    kaqgtgpngsdgagdawadfgmgyaadksvsgkadtwdqplagsfnqlkqlkaknpklkv
    mislggwtwsknfskaaateasrqklvsscidlyikgnlpnfegrggagaaagifdgidi
    dwewpgtnsglagngvdtvndranfkallaefrkqldaygstnnkkyvlsaflpanpadi
    daggwddpanfksldfgsiqgydlhgawnptltghqanlyddpadprapskkfsadkavk
    kylaagidpkqlglglaaygrgwtgaknvspwgpatdgapgtyetanedydklktlgtdh
    ydaatgsawrydgtqwwsydniattkqktdyivskglgggmwwelsgdrngelvgamsdk
    fraaapgpvteaapp