PDB entry 1kfu

View 1kfu on RCSB PDB site
Description: Crystal Structure of Human m-Calpain Form II
Class: hydrolase
Keywords: regulation, papain-like, thiol-protease, hydrolase
Deposited on 2001-11-23, released 2001-12-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: m-calpain large subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1kful1, d1kful2, d1kful3
  • Chain 'S':
    Compound: m-calpain small subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1kfus_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kfuL (L:)
    agiaaklakdreaaeglgsheraikylnqdyealrnecleagtlfqdpsfpaipsalgfk
    elgpyssktrgmrwkrpteicadpqfiiggatrtdicqgalgdcwllaaiasltlneeil
    arvvplnqsfqenyagifhfqfwqygewvevvvddrlptkdgellfvhsaegsefwsall
    ekayakingcyealsggattegfedftggiaewyelkkpppnlfkiiqkalqkgsllgcs
    iditsaadseaitfqklvkghaysvtgaeevesngslqklirirnpwgevewtgrwndnc
    pswntidpeererltrrhedgefwmsfsdflrhysrleicnltpdtltsdtykkwkltkm
    dgnwrrgstaggcrnypntfwmnpqylikleeededeedgesgctflvgliqkhrrrqrk
    mgedmhtigfgiyevpeelsgqtnihlsknffltnrarersdtfinlrevlnrfklppge
    yilvpstfepnkdgdfcirvfsekkadyqavddeieanleefdiseddiddgvrrlfaql
    agedaeisafelqtilrrvlakrqdiksdgfsietckimvdmldsdgsgklglkefyilw
    tkiqkyqkiyreidvdrsgtmnsyemrkaleeagfkmpcqlhqvivarfaddqliidfdn
    fvrclvrletlfkifkqldpentgtieldliswlcfsvl
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kfuS (S:)
    thysnieaneseevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtc
    rsmvavmdsdttgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfh
    lnehlynmiirrysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlql
    tmys