PDB entry 1kfu

View 1kfu on RCSB PDB site
Description: Crystal Structure of Human m-Calpain Form II
Deposited on 2001-11-23, released 2001-12-07
The last revision prior to the SCOP 1.61 freeze date was dated 2001-12-07, with a file datestamp of 2001-12-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kfuL (L:)
    agiaaklakdreaaeglgsheraikylnqdyealrnecleagtlfqdpsfpaipsalgfk
    elgpyssktrgmrwkrpteicadpqfiiggatrtdicqgalgdcwllaaiasltlneeil
    arvvplnqsfqenyagifhfqfwqygewvevvvddrlptkdgellfvhsaegsefwsall
    ekayakingcyealsggattegfedftggiaewyelkkpppnlfkiiqkalqkgsllgcs
    iditsaadseaitfqklvkghaysvtgaeevesngslqklirirnpwgevewtgrwndnc
    pswntidpeererltrrhedgefwmsfsdflrhysrleicnltpdtltsdtykkwkltkm
    dgnwrrgstaggcrnypntfwmnpqylikleeededeedgesgctflvgliqkhrrrqrk
    mgedmhtigfgiyevpeelsgqtnihlsknffltnrarersdtfinlrevlnrfklppge
    yilvpstfepnkdgdfcirvfsekkadyqavddeieanleefdiseddiddgvrrlfaql
    agedaeisafelqtilrrvlakrqdiksdgfsietckimvdmldsdgsgklglkefyilw
    tkiqkyqkiyreidvdrsgtmnsyemrkaleeagfkmpcqlhqvivarfaddqliidfdn
    fvrclvrletlfkifkqldpentgtieldliswlcfsvl
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kfuS (S:)
    thysnieaneseevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtc
    rsmvavmdsdttgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfh
    lnehlynmiirrysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlql
    tmys